PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr028831.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 455aa    MW: 50599.1 Da    PI: 5.4159
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr028831.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.85e-091659340
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                 +r C+ + +k+++++C  ++ +lC+ C ++ H+       H++v
  Pbr028831.1 16 ARACDSCIKKRARWYCAADDGFLCQACDSAVHSAnqlahrHKRV 59
                 578****************************9668899556655 PP

2CCT66.47.8e-23399442144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea+++RY+eKr+tR+F+KkirYe+RK +A++RpR+KGrFvk+a
  Pbr028831.1 399 REARVSRYREKRRTRLFSKKIRYEVRKLNAQKRPRMKGRFVKRA 442
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.5E-91461IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3241461IPR000315B-box-type zinc finger
PfamPF006432.0E-61659IPR000315B-box-type zinc finger
CDDcd000215.29E-81761No hitNo description
PROSITE profilePS5101715.864399441IPR010402CCT domain
PfamPF062031.6E-17399441IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MNSSKKVAHA VGGKTARACD SCIKKRARWY CAADDGFLCQ ACDSAVHSAN QLAHRHKRVL  60
LKTASSLKPS NKDDRASAVS ETSAAPSWHR GFTRKARTPR GGKSMTHHGK SEEGVRNLFP  120
QVPEVGGDDI NSYDEENKED QQLLYRVPIF DPFVAELCNN SGNSNEDAVA NYEANNLSTV  180
SDHVGIESKA VSSLPNFNCH DGFPLPSDMD LAEFAADVDS LLGRGVDDDE CFGMERLGFM  240
DCKKKESNGR VKLEEDDDQE GTDDVDFMGC QLGESEIDMM REPFALNFED YDDSPASCGE  300
QDDKLRVGSY SKCSTEDHER EDADDDARDN SKKRKMILRL DYEAVITAWD GSPWTSGDRP  360
DFDSECLPDY MGACGAELHY PYGEMNGLGV HPAMVDGGRE ARVSRYREKR RTRLFSKKIR  420
YEVRKLNAQK RPRMKGRFVK RASFAGSAFP VLAK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1409425RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009356271.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
TrEMBLM5XB520.0M5XB52_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g03520.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.13e-90B-box type zinc finger protein with CCT domain